SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289434481|ref|YP_003464353.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289434481|ref|YP_003464353.1|
Domain Number 1 Region: 292-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.64e-43
Family ABC transporter ATPase domain-like 0.0000816
Further Details:      
 
Domain Number 2 Region: 36-286
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 9.16e-21
Family DNA repair protein MutS, domain III 0.01
Further Details:      
 
Domain Number 3 Region: 709-784
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000144
Family Smr domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289434481|ref|YP_003464353.1|
Sequence length 785
Comment DNA mismatch repair protein MutS2 [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MDKKVEAILEFDKIKKQLTEFASSSLGEQAILALTPDTDFQVVQKAQLETEEGAKIIRLR
GSAPITGLTDVNAHLKRLEIGGDLNGLEIYQIGSNLRVSRQMKNFMADLHEVGVELPLLG
ALSEELLVLKDVEEDITISIDESGKVLDTASEALSSIRRTLRRTEDRVREKLESYLRDRN
ASKMLSDAVITIRNDRYVIPVKQEYKGHYGGIVHDQSASGQTLFIEPQSVVDLNNERKAL
QAKENQEIERILAEISASLAGWIKEIHHNTFILGRFDFILAKARFGKAMKAVTPHLSDNG
VVRLFAARHPLLEADKVVANDIYLGEDFTTIVITGPNTGGKTITLKTLGLLTLMAQSGLQ
IPTQEDSTIAVFEHVFADIGDEQSIEQSLSTFSSHMTNIVSILAKVNHKSLILYDELGAG
TDPQEGAALAISILDASHAKGASVVATTHYPELKAYGYNRAHATNASVEFNVETLSPTYK
LLIGVPGRSNAFDISRRLGLSETIITEARSLVDTESADLNDMISSLEEKRNLAESEYEEA
RELARGADALLKDLQKEISNYYQQKDKLIEQASNKAAKIVEKAEAEAEEIIHELRTMQLN
GAAGIKEHELIDAKTRLGKAKPKTINKTIPQAPKQKPHVFKNGDNVRVLSLGQKGTLLNK
INNTEWNVQIGIIKMKIKTTDLEYIQPEKPKKQRIITSVHSSDSPAKSELDLRGERYEDA
LQKVDKYLDEALLAGYPQVAIIHGKGTGALRTGVTEYLKNHRMVKSIRFGAAAEGGNGVT
IVEFK
Download sequence
Identical sequences WP_012985445.1.31702 gi|289434481|ref|YP_003464353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]