SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289434685|ref|YP_003464557.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289434685|ref|YP_003464557.1|
Domain Number 1 Region: 257-556
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.83e-91
Family DNA repair protein MutS, domain III 0.000000668
Further Details:      
 
Domain Number 2 Region: 559-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.4e-64
Family ABC transporter ATPase domain-like 0.00000081
Further Details:      
 
Domain Number 3 Region: 2-112
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 5.62e-42
Family DNA repair protein MutS, domain I 0.0000285
Further Details:      
 
Domain Number 4 Region: 114-269
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 3.14e-31
Family DNA repair protein MutS, domain II 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289434685|ref|YP_003464557.1|
Sequence length 860
Comment DNA mismatch repair protein MutS [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MTEYTPMIKQYLEIKDKYQDAFLFFRLGDFYEMFFEDALNASQILEITLTGREGGTKEKI
PMCGVPYHSASGYIDTLIEKGYKVAICEQVEDPKTTKGMVKREVVQLISPGTVMDERGLK
AKENNYIAALYCYEGKEYGFAYSDLSTGELKSTVIEASEDRLINELTTLSTKELIVSATE
KEVLSNVMKEQLGLTFSVHEEDTIPTENEKLVTRHMSLSEKRAIGKLLHYLKETQKRDLG
HLQQAVHYETSNYMKMDYYSKRNLELAASIRGKGRQGTLLWLLDNTQTAMGGRMLKQWID
RPLIDRNKIIERQNDVSELMAHFFERLELVENLKNVYDLERLAGRVAYGNVNARDLIQLR
NSLYQIPRIRATLLSMNTPSLTTLANQLDPCEELTEKLEEAIMDSAPISIREGGIIKDGY
NSQLDTYRDASRNGKTWIAELERKERELTGIKTMKVGFNRVFGYYIEVTRANTHLLPEGR
YERKQTLTNAERYITPELKEKEKLILDAEEKSMELEYQLFTEVRETVKDYIERLQKLAKS
VSEIDCLQSFADISEKNHFIRPTLSEDGSLHVKQGRHPVVEKVMGAQSYVANDCDLDANR
EILLITGPNMSGKSTYMRQVALTAICAQVGCFVPAEEAVLPIFDQIFTRIGAADDLIAGQ
STFMVEMLEARNAIVHATKDSLILFDEIGRGTATYDGMALAQAIIEYIHENVHAKTLFST
HYHELTDLEKELHGLQNIHVSAVEENGKVVFLHKIKEGPADKSYGIHVAELAELPTSLIE
RARRILEQLENDEKKIIISNEKQPEEIHEEVQLSMFPVEPEQKLPSKEAKLIKEIATLNI
MQMTPMDAMNKLYELQSKTH
Download sequence
Identical sequences gi|289434685|ref|YP_003464557.1| WP_012985601.1.31702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]