SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289434759|ref|YP_003464631.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289434759|ref|YP_003464631.1|
Domain Number 1 Region: 6-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-56
Family G proteins 0.00017
Further Details:      
 
Domain Number 2 Region: 408-503
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.97e-25
Family EF-G/eEF-2 domains III and V 0.0089
Further Details:      
 
Domain Number 3 Region: 301-379
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.71e-19
Family EF-G/eEF-2 domains III and V 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|289434759|ref|YP_003464631.1|
Domain Number - Region: 212-285
Classification Level Classification E-value
Superfamily Translation proteins 0.0459
Family Elongation factors 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289434759|ref|YP_003464631.1|
Sequence length 608
Comment GTP-binding protein LepA [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MNKEEMNARQKKIRNFSIIAHIDHGKSTLADRILEKTGALTHREMKNQLLDSMDLERERG
ITIKLNAVQLKYKAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQ
TLANVYLALDNDLEILPVINKIDLPAADPERVREEIEDVIGLDASDAVLASAKSGIGIED
ILEQIVEKVPEPTGDVTKPLKALIFDSVFDAYRGVIANIRVMDGVVKAGDRIKMMSNGKE
FEVTEVGVFSPKATPQDELLVGDVGYLTAAIKNVGDTRVGDTITLANNPAEEALDGYRKL
NPMVYCGLYPIDSSKYNDLRDALEKLELNDSALQFEAETSQALGFGFRCGFLGLLHMEII
QERIEREFNIDLITTAPSVIYHVNLTDGSNIIVDNPAEMPEPGIIESVEEPYVKATVMVP
NDYVGAVMELAQNKRGNFITMEYLDDIRVSIVYEIPLSEIVYDFFDQLKSSTKGYASFDY
ELIGYKASKLVKMDILLNAEKVDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQA
AIATKIVSRSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMA
ILKMDETK
Download sequence
Identical sequences A0A0F5YXW5 E3ZQL5
gi|289434759|ref|YP_003464631.1| WP_003747743.1.27649 WP_003747743.1.31702 WP_003747743.1.71328 WP_003747743.1.96308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]