SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289434799|ref|YP_003464671.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289434799|ref|YP_003464671.1|
Domain Number 1 Region: 112-297,426-586
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.19e-103
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000109
Further Details:      
 
Domain Number 2 Region: 294-421
Classification Level Classification E-value
Superfamily GAD domain-like 9.16e-41
Family GAD domain 0.00013
Further Details:      
 
Domain Number 3 Region: 4-108
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.24e-32
Family Anticodon-binding domain 0.0000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289434799|ref|YP_003464671.1|
Sequence length 591
Comment hypothetical protein lse_1434 [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MEKRTSYCGELNETHIGQNVILHGWVQKRRDLGGLIFIDLRDREGIIQVVFNPETSKEAL
AIADSVRNEFVVTIKGKVSARSENAINEKLATGKIEISAEEITILNTSKTPPFYIEDGVN
VSDELRLKYRYLDLRRPEMNNIFKMRHTVTRTFRNKLDALGFFDIETPYLTKSTPEGARD
YLVPSRVYPGNFYALPQSPQILKQLLMTAGFDKYYQIVRCFRDEDLRGDRQPEFTQIDLE
TSFLTKEEIQTITEDMLIDVVKEAKNITIQKPFPRMTYKEAMDRFGSDKPDIRFGLELQN
VSEVVKDVDFKVFQSAVENGGEVKAINAKGAATNFSRKDLDALGVFVANYGAKGLAWLKV
EAGELKGPIAKFFQAEKAQELMAALQAEDGDLLLFAADKAEVVAASLGALRNKLGKELAL
INEEELAFLWVTDWPLFEYDEEAGRYVSAHHPFTLPKEEDIPLLETDSSKVMAEAYDIVL
NGYEIGGGSLRIYKKEVQESMFRALGFTDEAASEQFGFLMEALEYGTPPHGGIALGLDRI
VMILAGRNNLRDTIAFPKTGSAVDPLTNAPGEVSEAQLAELKLATVKKESN
Download sequence
Identical sequences gi|289434799|ref|YP_003464671.1| WP_012985681.1.31702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]