SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289434837|ref|YP_003464709.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289434837|ref|YP_003464709.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 1.7e-42
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00059
Further Details:      
 
Domain Number 2 Region: 162-313
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.6e-27
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00055
Further Details:      
 
Domain Number 3 Region: 319-418
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.00000000000405
Family Glutamyl tRNA-reductase dimerization domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289434837|ref|YP_003464709.1|
Sequence length 437
Comment hypothetical protein lse_1472 [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MFILTMGLNHHTAPIDIREKLVFKETEEEMALITLLQEKSILENVIISTCNRTEIVAVVD
QLHTGRYYLKRFMANWFQMDMEKIEPYLFFHEEAVAVNHLYKVTAGLDSLVLGETQILGQ
VKHAFEIAKHTGTTGTLLNKLFREVVTFAKKVHHYTKINENAVSVSYAAVEVAKKLYGTL
ENKKIVLVGAGEMSELALQNLAGSGINDITVINRTQMNAEILANQFQAKVVAYEQMNEHL
LLADIVLVSTSASEPIIKHTEMQQLMEQKASSMLVIDIGLPRNVEHDCSYIPNFHLYDID
DLAGVVTANSMERKRIVSELEDTIHAEVQTFFEWEKQLGVVPVIRALREKALEMQEVTMT
SLENKLPGLTEREYVQIGKHMKSIINQMLKQPISELKEMSVESDAETSIDYFKRIFGLVD
IAVSVPDKEQAETRSKA
Download sequence
Identical sequences gi|289434837|ref|YP_003464709.1| WP_012985706.1.31702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]