SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289435163|ref|YP_003465035.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289435163|ref|YP_003465035.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-83
Family Protein kinases, catalytic subunit 0.000000998
Further Details:      
 
Domain Number 2 Region: 504-564
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000085
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|289435163|ref|YP_003465035.1|
Domain Number - Region: 367-428
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289435163|ref|YP_003465035.1|
Sequence length 655
Comment protein kinase [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MMIGKRLNDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYEKAVDIMLQIVS
AVTVAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQADIPSARAQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNQDRLNEPKYIFPTDDGDTKTIPIIATKE
AMQNLDKTIVPEGKVAAEEVEPDDKKGKKKKKMSKKKKIAWIVFSVIIVFIIAILLLWML
GKGPEEIAVPDVSGKTEDQAIALLQKDGFVIGKTAEKNSDDVDEGKVINTDPDAGEMKEK
GTKVNLFVSIGSKKITMDDYTGRSYDDTKALLEEQGFKNISSEESYSAEVDKGMIISQTP
SAGSNVVAKSTDVKFVVSKGAEPITLKDLRGYTKTAVEDYASPLGLKVSSSEENSSSVEK
GQVISQSPSSGTTMNPGDTIEIVISAGPKEKTVKEVTKTFNISYTPSDEENPEPQHIQIY
IQDKDHSMTSAYREMDISQNTSVEVTFQIEEGTSGGYKIISDDKVIDEGTVPYPN
Download sequence
Identical sequences WP_012985963.1.31702 gi|289435163|ref|YP_003465035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]