SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289435380|ref|YP_003465252.1| from Listeria seeligeri serovar 1/2b str. SLCC3954

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289435380|ref|YP_003465252.1|
Domain Number 1 Region: 194-607
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.07e-92
Family beta-Lactamase/D-ala carboxypeptidase 0.00000104
Further Details:      
 
Domain Number 2 Region: 56-242
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.7e-45
Family Penicillin binding protein dimerisation domain 0.0000235
Further Details:      
 
Domain Number 3 Region: 603-657
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000484
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0033
Further Details:      
 
Domain Number 4 Region: 659-713
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289435380|ref|YP_003465252.1|
Sequence length 752
Comment penicillin-binding protein [Listeria seeligeri serovar 1/2b str. SLCC3954]
Sequence
MKRRIGNMRRGALVLFIFFTILFLLVSGRFLYLQITGEANGVPLAAKASKQHLKSSVIEA
KRGSILDRKGEVLAEDTASYTIAAVVSDKLPKTTKNPMRVVDEEKTAQVLAKYIPMDESD
ILDKLNEKGKYQVEFGAAGKNISTETKAAIEKEDLPGIEFTRQSERFYPNGTFATQLIGF
AQQEEEKNTTVLEGKMGIESQYNDKLTGTNGKIDYSTDRMGYILPNSKNKVTKAKDGEDI
TLTLDKKIQTFLEDTMTTVDAKYNPKNMMAVVADPKTGEILAISQRPSFNPADRSTITGN
SSSIWQDLPVEYAYEPGSVMKIISLASAIDSNVYNPNEYYQSGTYNVGDIPIHDHNNGAG
WGSITYREGVERSSNVAFAKLLNKMGTDTFHTYLDEFGFGKKTGIDLPNETSGKILYNYP
IEKVTTVFGQGTTVSMMQMIQAASAIASDGTMKQPYVVSKVTDPNTGKTTETKTKNAGKP
ISAETAKKTRDELKNVISGEHGTGKLYAIPGYDVAGKTGTSQIPDPKTGKYMTGADNYIF
SFLGMAPADDPELVIYVTMQQPQLSGSETGGEAVSEVFNPVMKNSLQYMNIKPGDAEKLA
SEKVPVLADKSVADAKKAVSDKGLEPIVVGNGKKIVQQLPQANSDLMQGQKVILMTDGDM
TAPDMVTWSKDDALKVSEITGVPFEFSGSGYVKSQSVSAGSVINSKTKMKITLAPPEQIS
QFNQNHDQDEAEKNKKATDIQENAGIGDLLNQ
Download sequence
Identical sequences gi|289435380|ref|YP_003465252.1| WP_012986138.1.31702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]