SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262340836|ref|YP_003283691.1| from Blattabacterium sp. (Blattella germanica) str. Bge

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262340836|ref|YP_003283691.1|
Domain Number 1 Region: 89-286
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.4e-54
Family B3/B4 domain of PheRS, PheT 0.0000507
Further Details:      
 
Domain Number 2 Region: 583-681
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 5.75e-24
Family Anticodon-binding domain of PheRS 0.0019
Further Details:      
 
Domain Number 3 Region: 357-574
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.29e-20
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0026
Further Details:      
 
Domain Number 4 Region: 293-365
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000266
Family Domains B1 and B5 of PheRS-beta, PheT 0.013
Further Details:      
 
Domain Number 5 Region: 3-69
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000531
Family Domains B1 and B5 of PheRS-beta, PheT 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262340836|ref|YP_003283691.1|
Sequence length 684
Comment phenylalanine-tRNA ligase subunit beta [Blattabacterium sp. (Blattella germanica) str. Bge]
Sequence
MAKKYISININVETLSCILTDIGLPVKSIIKKIFDEVEDSILDVEVTPNRTDAMSHYGIA
RDLYAILKFRGYTVNLSKPTIINDNFSHHNSHIQILVQENKKCIRYSGMSIYKIKIEPSP
HWLVSRLKSIGINSINNITDVINFVMYELGQPIHVFDMDQIEGKKIIIKNAEKNTYLKSS
DSITRKLDEDDLIICDINKPLSLSGIINSIQSDIHANTKNIFLGSAYFSPIFIRSIGKKH
FLKTESQYLFERGTDPNQTVYALQRTAFLIKNITKIKTYSHITDIYPSPISYSMIHLRYQ
KIRNILGKKISKKKIKKILSLLEIVIHAENDKYLFVGVPPYRIDVNREIDLIEEILRING
INKIKISDQIKISPLPNFCYKTEYKIQKILFEQLVCYGFQEIISSTMRNENQYSTLFNSF
FNREEIKILNPINQNYKFMRSSLLFGMIDCIEFNCKKINYDNSNIKFFEIGKIYYKQNNK
FLEKTYLGIAILQKIEKKYIDFKPFFYLKGIVEQIFQKSGICNYTQIYSKHPLLENSISI
LYNNRNLVELGKFKNNILRKKEIFYAEIDWEYLISIIQQKKITYIPFSKYPTSRRDLSLL
VDKTISFEKINQLIKKKESHIIRKIKIYDFYESENLPQSKKSYTISFFFESQKETLTEKI
INNSMKKIEFFLKKELKAEIREKK
Download sequence
Identical sequences D0JA93
WP_012840596.1.74512 331104.BLBBGE_047 gi|262340836|ref|YP_003283691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]