SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262341192|ref|YP_003284047.1| from Blattabacterium sp. (Blattella germanica) str. Bge

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262341192|ref|YP_003284047.1|
Domain Number 1 Region: 12-199
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.95e-54
Family PP-loop ATPase 0.0000471
Further Details:      
 
Domain Number 2 Region: 355-437
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000154
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262341192|ref|YP_003284047.1|
Sequence length 456
Comment PP-loop family protein [Blattabacterium sp. (Blattella germanica) str. Bge]
Sequence
MITYDHIEKIRKYFSLKNKICVAVSGGLDSMVLVNLLLDLSNIELEVAHCNFTLRNQESD
EDEVFIKNFCTKKNIICHVKRFDTLNFSKKNKLSIQMAARKLRYDWFFELLKKIDYDYIV
LGHHLNDSIETFFLNILRGTGIKGLLGIPKKNGKFIRPLSDFTKEEILHYAKIKNIKWRL
DSSNLETKYLRNKIRFILSKFSYFSSFFCKGFKKTINHLYDENFLIEEKIKKVYHEITVD
KKNHPFIWKIKCNKIEKLQPLSFYLFKLFSPYGFYNVKSLKNLIYAQSGKQLISKKYRII
KNRNDWILVYRKFLSENKTYAIPDIRNVVQTPLPIDMKFLLNPKKEDQEKEKMFLIDFDK
IQFPLLLRTWRKGDFFFPFKMKGKKKLSKYYKEKKFSLLEKEQTWLLINGNGDIILVVGN
RLDDRFKITKKQKNIRYKNIIELLPTNLTISIGIFF
Download sequence
Identical sequences D0JB99
WP_012840952.1.74512 gi|262341192|ref|YP_003284047.1| 331104.BLBBGE_429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]