SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260597366|ref|YP_003209937.1| from Cronobacter turicensis z3032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260597366|ref|YP_003209937.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 1.44e-29
Family YccV-like 0.00000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260597366|ref|YP_003209937.1|
Sequence length 105
Comment heat shock protein HspQ [Cronobacter turicensis z3032]
Sequence
MIASKFGIGQQVRHSLLGYLGVVVDIDPEYSLEEPEVDEMAVNAELRAAPWYHVVMEDDD
GQPVHTYLAEVQLSGERQEEHPEQPSMDELARSIRQQLQAPRLRN
Download sequence
Identical sequences C9Y0Q8
WP_015740768.1.21474 413502.Ctu_15740 gi|260597366|ref|YP_003209937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]