SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260597123|ref|YP_003209694.1| from Cronobacter turicensis z3032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260597123|ref|YP_003209694.1|
Domain Number 1 Region: 107-236
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 9.77e-40
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.000000211
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.12e-29
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260597123|ref|YP_003209694.1|
Sequence length 238
Comment succinate dehydrogenase iron-sulfur subunit [Cronobacter turicensis z3032]
Sequence
MKLEFSIYRYNPDVDDAPRMQDYTLEQEEGRDMMLLDALMLLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPVSNLGAGKQKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGHNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETNERLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
Download sequence
Identical sequences A0A0K2PFB3 C9XZA4 K7ZZB4 K8AX45 K8BF83 K8DTX4
413502.Ctu_13310 gi|260597123|ref|YP_003209694.1| WP_007669742.1.21474 WP_007669742.1.31158 WP_007669742.1.45413 WP_007669742.1.49002 WP_007669742.1.5375 WP_007669742.1.58180 WP_007669742.1.65518 WP_007669742.1.70246 WP_007669742.1.7880 WP_007669742.1.80198 WP_007669742.1.8442 WP_007669742.1.94188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]