SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157828622|ref|YP_001494864.1| from Rickettsia rickettsii str. 'Sheila Smith'

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|157828622|ref|YP_001494864.1|
Domain Number - Region: 13-40
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00942
Family Apolipoprotein 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157828622|ref|YP_001494864.1|
Sequence length 56
Comment hypothetical protein A1G_04250 [Rickettsia rickettsii str. 'Sheila Smith']
Sequence
MHDNELNKKIEYFDNLKSKREKWNQRWDELKRYVCPQTERNKVIFDSTSIGSLVHQ
Download sequence
Identical sequences A0A0H3AV01
gi|378721439|ref|YP_005286326.1| 392021.A1G_04250 gi|378724143|ref|YP_005289027.1| gi|379017930|ref|YP_005294165.1| gi|378722788|ref|YP_005287674.1| gi|157828622|ref|YP_001494864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]