SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157828937|ref|YP_001495179.1| from Rickettsia rickettsii str. 'Sheila Smith'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157828937|ref|YP_001495179.1|
Domain Number 1 Region: 33-148
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000000196
Family Apolipoprotein 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157828937|ref|YP_001495179.1|
Sequence length 155
Comment hypothetical protein A1G_06055 [Rickettsia rickettsii str. 'Sheila Smith']
Sequence
MKKFLITLGATATLLLTPSIFADLPTKDETTANEVQTAEVATSSTKTITENLQELKDNLT
NLAQTGADKFNQTLSNTYDQIAQSVTEIKKNVKDQKDKQGEELQKSIDAVKAKMEAYKKA
GSKKQEKIRQHLVDKLEELNKNINEYNNDEEKANS
Download sequence
Identical sequences A0A0H3AXH4 Q9AKF2
gi|379016001|ref|YP_005292236.1| gi|378721754|ref|YP_005286641.1| gi|378723101|ref|YP_005287987.1| gi|378724454|ref|YP_005289338.1| gi|157828937|ref|YP_001495179.1| 392021.A1G_06055 WP_012151224.1.17801 WP_012151224.1.31136 WP_012151224.1.3339 WP_012151224.1.38731 WP_012151224.1.4490 WP_012151224.1.74071 WP_012151224.1.77680 WP_012151224.1.78650 WP_012151224.1.81845 WP_012151224.1.83836 WP_012151224.1.89241 gi|379018240|ref|YP_005294475.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]