SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452852296|ref|YP_007493980.1| from Desulfovibrio piezophilus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452852296|ref|YP_007493980.1|
Domain Number 1 Region: 173-553
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.11e-88
Family beta-Lactamase/D-ala carboxypeptidase 0.0003
Further Details:      
 
Domain Number 2 Region: 60-221
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.14e-40
Family Penicillin binding protein dimerisation domain 0.0013
Further Details:      
 
Domain Number 3 Region: 591-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452852296|ref|YP_007493980.1|
Sequence length 652
Comment Peptidoglycan glycosyltransferase [Desulfovibrio piezophilus C1TLV30]
Sequence
MAKGSQGRKDHSRVKIGLVMVLFTLALSSLWVRTGWVQLHEGDILLSKASKQSHAAEFEY
GARGRIFDRNGQMLATSVEAKSVYVRPFEIENVDVAADTLSRSLNMSRSKIYKRLKSRKK
FVWIKRQVTDREALGIEQADLKGVRLVSEYSRIYPNGHLAGQTIGFVNIDGKGLEGIERV
YNDRLKPGKAEFVVQRDAKGQRLYLDDLGREMNINGLDVRLTIDTHIQHAAEQSLAKTIA
KYDARAGIVMVVDVDSGDILAMANQPFFNPNAVSHSKASHRRLRPITDIYEPGSTLKPFL
FAAALEEGVIEPDTLIDCENGRWKVARKVIRDTHPKKWLPAHKVLRYSSNIGSAKIGMDL
GAGVYYSYLTKLGFGEKVGIGLPGEAAGILMPPERWTSMDLAAISFGQGIGTTAMQLAKA
YLCLANNGITKDLNLVKEPAPHRPNTSVRIFKPETVDMVLSMMKEVVHEDGTGRSARIPG
ITMAGKTGTAQKAAKGGYGDQYLSSFVALVPAKNPEILVITMVDEPQKANYGSMVAAPVC
REVTVRTLAYYGKLSETLNTAMAEDVSMDVLVEHPIHGSVETPQSHPMTERVPDIIGMPV
RRALEMLARKGIVPVLKGEGMTVKGQTPAAGQPWPDESNTEGTNDVFVLRLS
Download sequence
Identical sequences M1WQ86
WP_015414873.1.59876 gi|452852296|ref|YP_007493980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]