SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157373147|ref|YP_001471747.1| from Shewanella sediminis HAW-EB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157373147|ref|YP_001471747.1|
Domain Number 1 Region: 128-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-44
Family Extended AAA-ATPase domain 0.00000835
Further Details:      
 
Domain Number 2 Region: 358-461
Classification Level Classification E-value
Superfamily TrpR-like 4.19e-37
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157373147|ref|YP_001471747.1|
Sequence length 462
Comment chromosomal replication initiation protein [Shewanella sediminis HAW-EB3]
Sequence
MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAQMDGDTLVLYAPNRFVLDWVRDKYINIIN
QFFTEQMGSDAPKLRFDIGSRPSAPRPVQATAAVERPKFEQNTKPAKTSFNVNSPEPAMA
ANHRSNINRTYQFENFVEGKSNQLGKAAAMQVAENPGGAYNPLFLYGGTGLGKTHLLHAV
GNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALFIDDIQFFANKDR
SQEEFFHTFNALLEGNHQIILTSDKYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAI
LMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRD
LLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVARPRQVAMALSKELTNHSLPEI
GDAFGGRDHTTVLHACRKIAQLREESHDTKEDYANLIRTLSS
Download sequence
Identical sequences A8FP46
gi|157373147|ref|YP_001471747.1| WP_012004145.1.70442 425104.Ssed_0006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]