SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157375915|ref|YP_001474515.1| from Shewanella sediminis HAW-EB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157375915|ref|YP_001474515.1|
Domain Number 1 Region: 26-532
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.2e-104
Family Pyridoxal-dependent decarboxylase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157375915|ref|YP_001474515.1|
Sequence length 550
Comment pyridoxal-dependent decarboxylase [Shewanella sediminis HAW-EB3]
Sequence
MTARQAKASEEALLRIFTIPEAPGSTLSVIEQNISQNLMGFLQESVVAVEKPLTEIERDF
QEHQIPAAPKFVSDYADEMMKTLVAHSVHTSAPSFIGHMTSALPYFVLPLSKMMVGLNQN
LVKIETSKAFTPLERQVLGMMHHLIYDENETFYNSWMHSANVSLGAFCSGGTVANITALW
TARNQLLKADGDFKGIAAQGLMKGLRHYGYNDLAILVSERGHYSLGKTADLLGIGRENII
QIPTSNDNRVDVDKMRVTAKALERDNIKVMAIVGVAGTTETGNIDPLDKLATLAEELDCH
FHVDAAWGGASLLSKKYRHLLKGIERADSVTIDAHKQMYVPMGAGMVIFKDPTFANAIKH
HAEYILRKGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAELIK
TTDNFELVSEPELCLLTYRYVPESVQKAMQQARTDGDIERLLQFNRLLDGLTKFVQKRQR
EQGTSFVSRTRINPEHCHDIDVDLKSVVFRVVLANPLTTNEILQQVLVEQTQIASTDKKF
LPQLLELAAH
Download sequence
Identical sequences A8FX14
gi|157375915|ref|YP_001474515.1| WP_012143117.1.70442 425104.Ssed_2780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]