SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161527675|ref|YP_001581501.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527675|ref|YP_001581501.1|
Domain Number 1 Region: 36-315
Classification Level Classification E-value
Superfamily SIS domain 1.57e-38
Family double-SIS domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161527675|ref|YP_001581501.1|
Sequence length 323
Comment RpiR family transcriptional regulator [Nitrosopumilus maritimus SCM1]
Sequence
MCEVYDKWPELARKAFFQPTEKIDFKDINEIIFSGMGGSGSIGDGFSSIFSKTNLNVSTI
KGFHLPESINPKTLVIPISVSGNTIETHTVLKQAKKRGCKIIAFSSGGKIEKFCNNNKIE
YRQIPIVHSPRASFVSFFYSILNTLEPMIPLKQNIILKSINDLEQLSKNIASHKLDKKNK
SLELAKWINNIPIIYYPNGFKAAAIRFKNSLQENAKLHAMSEDIIEMSHNGIVSWEKTSS
IQPILLEGKDDYIKTKKLQKIVKEYFKKNHIQYNVISSPTGSILTKLVYLIYLLDYSSIY
KAIIEKIDPSPVKSIEFLKKKIN
Download sequence
Identical sequences A9A1U2
436308.Nmar_0167 gi|161527675|ref|YP_001581501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]