SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161527695|ref|YP_001581521.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|161527695|ref|YP_001581521.1|
Domain Number - Region: 81-147
Classification Level Classification E-value
Superfamily E set domains 0.0297
Family Cellulosomal scaffoldin protein CipC, module x2.1 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161527695|ref|YP_001581521.1|
Sequence length 174
Comment hypothetical protein Nmar_0187 [Nitrosopumilus maritimus SCM1]
Sequence
MAKKRSVLILSFLILFSIPGLGDAFAHSMFNSAEQSNGGYRVQVATAPEFPQIGEPSQFL
VKVTEGFDYEDVDRFTMGMKIFYNGKQVDAIQPTSVEGSHWDFDYVWRNSGNHIVDVYLY
DMPNNPEPLSFKFNMGTQSPFGQIFIIAITIGALSMTGVFLYIYMPKIFKKSRL
Download sequence
Identical sequences A9A1W2
436308.Nmar_0187 gi|161527695|ref|YP_001581521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]