SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161527748|ref|YP_001581574.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527748|ref|YP_001581574.1|
Domain Number 1 Region: 38-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.28e-44
Family Extended AAA-ATPase domain 0.0000167
Further Details:      
 
Domain Number 2 Region: 230-313
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.0000000000106
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161527748|ref|YP_001581574.1|
Sequence length 316
Comment replication factor C [Nitrosopumilus maritimus SCM1]
Sequence
MAATGMWVEKYRPMKLSEVVNQTEIIGSLEALIKDPTDMPHLLFSGSAGVGKTTTALCIS
RQILGDYAKDYTLELNASDERGIGMVREKVKKFSRYAGMADVPFKIIILDEADEMTSDAQ
TALRRIIEDTAKICRFILIANNISKIIDPIQSRCATFKFTAVPEEDVIKRLEEIAKKEKV
KADKKGLKAIYDYSEGDLRHAINLMQATASLGSISEDNVKASAGLTKTTDVDEVLKIALS
GKVPEAREKMIELIKVYGMSESDFLKYLNSAVFKSKHDKLSDILEIIAKYDYRILVGSNS
EIQLSAMLAELAKVEN
Download sequence
Identical sequences A9A308
gi|161527748|ref|YP_001581574.1| 436308.Nmar_0240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]