SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161527831|ref|YP_001581657.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527831|ref|YP_001581657.1|
Domain Number 1 Region: 245-585
Classification Level Classification E-value
Superfamily SIS domain 2.32e-91
Family double-SIS domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 2-232
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.2e-65
Family Class II glutamine amidotransferases 0.00000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161527831|ref|YP_001581657.1|
Sequence length 586
Comment glucosamine--fructose-6-phosphate aminotransferase [Nitrosopumilus maritimus SCM1]
Sequence
MCSIIGYYGKETAAPIIVKGLKRMEYRGYDSVGVATESENQIGLKKGTGKVQEVNSKVQL
ETLPGRVGIGHTRWATHGKVTDVNAHPHPSNSGKIAIVHNGIIENFEELKKELESDGYVF
KSETDSEIISNLLQKHHDQTKNVKETILKTVSQLKGHYSFVAMFEDGQLAAARFHEPLII
GVGKDDYFLSSDVLGFIEFTDNAIYMENGTFVIFDKNKFQISDFNGEQTGYEITKVSKEF
GDAYKGDYAHFTLKEIYEQPETILKAGEKTSSEIEAATDYIRQAKNIYITGSGTSYNSAL
IAKQILSKYVKIKTESIMSSELQFDPNIIEENSILIAISQSGESADVLEAVKIAKNANCK
IIAIVNLVTSSLAREADVVIGLNCGPEIGVAATKSFTSQLVILYKIVQKLSNNDITINFE
DFSKSISKTLDNPTNIQKIAKELKEISDIYILGRGINYPIATESALKLKELTYIHAEGIA
GGELKHGPLALMDSNVFVIILNPNDSTYSDTLTSAREIKARGAKIIGVSDVKSDVYDYWI
EMPKINEVLYPISEIIPIQLLSYYAALEKDTDPDYPRNLAKSVTVK
Download sequence
Identical sequences A9A435
gi|161527831|ref|YP_001581657.1| 436308.Nmar_0323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]