SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161527971|ref|YP_001581797.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527971|ref|YP_001581797.1|
Domain Number 1 Region: 81-176
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000114
Family Multidrug resistance efflux transporter EmrE 0.013
Further Details:      
 
Domain Number 2 Region: 233-327
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000772
Family Multidrug resistance efflux transporter EmrE 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161527971|ref|YP_001581797.1|
Sequence length 333
Comment hypothetical protein Nmar_0463 [Nitrosopumilus maritimus SCM1]
Sequence
MSVVSKFQPTYENLRKSKINKISLFSKLKSKTVGVGFLFAILAAAFSALPNVIPKSFLDA
HAVDTSTIPNPLMLVFVIYVVNSLLFSPFRKSQREHEVKKTSRMTLFLLILLGAVEASGT
LTYTFGLQETSATNASILVNSETVFAILLGIMIFREKLSKQEVLPFFLIVAGSILIPVGA
DIQNNEWELSDFMMGDLLIVMSGFFYCLDTFIAKKLDDSIKTRHIVHIMSCTGAIMTLGL
MLFFEIPFDISFEELSVMSFVGFLGIGVTMMFFVIALRLIGAVRTVLIYSSTTIFSIVYS
ILILSEGLTILNIVSTSSVLIGLFVLRNRVGSD
Download sequence
Identical sequences A9A173
gi|161527971|ref|YP_001581797.1| 436308.Nmar_0463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]