SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161527994|ref|YP_001581820.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161527994|ref|YP_001581820.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily GlnB-like 2.03e-19
Family Prokaryotic signal transducing protein 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161527994|ref|YP_001581820.1|
Sequence length 100
Comment hypothetical protein Nmar_0486 [Nitrosopumilus maritimus SCM1]
Sequence
MKLYNVKLLTITCEILAQENIIEILKKHEITGYTTYEVDGNGARGLRGQGLKTEKNVKVE
VIMREEKLQDIVEEISRTLFANYAIVLYVSDVGVLRPEKF
Download sequence
Identical sequences A9A196
gi|161527994|ref|YP_001581820.1| 436308.Nmar_0486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]