SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161528152|ref|YP_001581978.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528152|ref|YP_001581978.1|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily AlbA-like 0.00000000000034
Family DNA-binding protein AlbA 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161528152|ref|YP_001581978.1|
Sequence length 77
Comment DNA-binding protein [Nitrosopumilus maritimus SCM1]
Sequence
MTYVSATLTQLSTRQTVTIKARGKRITQAVDVSQMIVKRMDSVGYVISDVRISSDSLTSQ
DGKQRNVSTMEIDISKE
Download sequence
Identical sequences A9A3B1
436308.Nmar_0644 gi|161528152|ref|YP_001581978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]