SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161528181|ref|YP_001582007.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528181|ref|YP_001582007.1|
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily CBS-domain pair 7.55e-32
Family CBS-domain pair 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161528181|ref|YP_001582007.1|
Sequence length 165
Comment signal-transduction protein [Nitrosopumilus maritimus SCM1]
Sequence
MIFRNDNLKSNHIVNKLKKYVENTFVNQIMSKNVLTVKVSETLEEVAKKMKEENVGCVIV
VDKIATLGIVTERDFVTKIVAERKTPHTKIFEVMSSPLITIKSESTIWEAAEIMKEKSIH
KLPVIEDEEIVGIITTTDIVRISSVGSDSQMRKICDQILMRMKDD
Download sequence
Identical sequences A9A480
436308.Nmar_0673 gi|161528181|ref|YP_001582007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]