SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161528242|ref|YP_001582068.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528242|ref|YP_001582068.1|
Domain Number 1 Region: 5-170,199-237
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.48e-44
Family FAD-linked oxidases, N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 240-469
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 3.6e-42
Family Cytokinin dehydrogenase 1 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161528242|ref|YP_001582068.1|
Sequence length 481
Comment FAD linked oxidase domain-containing protein [Nitrosopumilus maritimus SCM1]
Sequence
MNSVETQLKKIIRGKVHSETEFRKFYSVDASSYQIFPKTIVIPKNEKDVINTIKIAKKYK
TNVTVRGAGTGLVGSALNNGIILDMKNFDSIKIKKNYAIVGTGVVKGKLDEKLERYRKFF
PPNPSVGSFCSIGGMLGNNSSGSRSLKYGSMIDNVLEVTIIDGNEKKIVLPKDEKLSNKI
QKKIKIDEKKIPKVSKNSSGYRIDKIISNKDSHKIIVGSEGTLGIIISAKLKIKNIPKKR
ILFVVEYNSIKNAINDCLTINKTNPSAMEFVDKITLQQINHKFHKNTKCLLFVEYDEKIS
QNMKKFKMIISGNIIKKLTKKQDIFQWWKYRDSSLYYSLKNIKKENRIPHVIEDAAVPIE
KLPELFDILDKINKKFKTKSVIYGHIGNGNLHVRLIGKRKKITQIKNIAKQYFDEIINIG
GTITAEHGDGLARSEFIKKQYGKINFETFQKIKNQFDPNNVLNPGKIISEKSTIIKNFEK
L
Download sequence
Identical sequences A9A4E1
gi|161528242|ref|YP_001582068.1| 436308.Nmar_0734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]