SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161528390|ref|YP_001582216.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528390|ref|YP_001582216.1|
Domain Number 1 Region: 7-146
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 2.35e-43
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.0000787
Further Details:      
 
Domain Number 2 Region: 148-277
Classification Level Classification E-value
Superfamily Translational machinery components 4.19e-35
Family ERF1/Dom34 middle domain-like 0.00063
Further Details:      
 
Domain Number 3 Region: 279-422
Classification Level Classification E-value
Superfamily L30e-like 1.99e-25
Family ERF1/Dom34 C-terminal domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161528390|ref|YP_001582216.1|
Sequence length 426
Comment peptide chain release factor 1 [Nitrosopumilus maritimus SCM1]
Sequence
MGKIDIEKQDSVKVYKIRKTLEELSKKSGRGTELITVYIPKGKQLHEIIGTLQQEQGTAD
NIKSDLTRSHVVDSLGKVVQRLKLYKKTPERGLVMFCGALPPEEGGPLGSEVVKVWEIDP
PKDLNQYLYRCDDHFHVDILKDMLKDDNLIGFLAIDSKDAGWGLLHGDKIEVLAQTGSGV
AGKHRQGGQSAKRFQKLREMELTYYFNRVAQTTREYFIDIYPVKGLVISGPGPTKEDFIN
GNYLEYRLQNNIIATIDSSYSGSEGIREAFAKSSDILGNFRLVEEKKLVEALFREINGNT
GKGSYGLQEVIDFLKNNVVETLIITDNTNLNRVEGICKRCKHLQEDIVERPDVIPKKTEY
SSKPCPGCNAMEVEVNEQDIVDYLELIASKTGSQLEVVSGSAEHGNMLASLGKIGAILRY
NPGHSK
Download sequence
Identical sequences A9A1E3
gi|161528390|ref|YP_001582216.1| 436308.Nmar_0882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]