SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161528458|ref|YP_001582284.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528458|ref|YP_001582284.1|
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 6.15e-40
Family Triosephosphate isomerase (TIM) 0.00000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161528458|ref|YP_001582284.1|
Sequence length 218
Comment triosephosphate isomerase [Nitrosopumilus maritimus SCM1]
Sequence
MFVINCKNYEEISGEKITKFVKTAEKVSKKFKVKIAICPPQHLIGVVANSSIPIFAQHID
DSKVGSTTGFVIPELLKKSQVNGSLINHSEHRISSKEITKLVSKLKELKMTSIVCVKDVA
EARKYAKLNPNYIAIEPPELIGSGKAVSTERPELITKAANAVKSANNNTKLLCGAGIVSG
QDVSKAVELGSKGILVASGIIKAKNWDKIISEFAKALV
Download sequence
Identical sequences A9A2D5
436308.Nmar_0950 gi|161528458|ref|YP_001582284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]