SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161528515|ref|YP_001582341.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528515|ref|YP_001582341.1|
Domain Number 1 Region: 195-339
Classification Level Classification E-value
Superfamily CBS-domain pair 6.22e-33
Family CBS-domain pair 0.0027
Further Details:      
 
Domain Number 2 Region: 334-419
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6e-17
Family CorC/HlyC domain-like 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|161528515|ref|YP_001582341.1|
Domain Number - Region: 91-153
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00397
Family Bacteriorhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161528515|ref|YP_001582341.1|
Sequence length 422
Comment hypothetical protein Nmar_1007 [Nitrosopumilus maritimus SCM1]
Sequence
MSLEYQLAALAGLIGLSGFFSGLEVALVGTSQATIERLVKDNVKGAKSLQKLKANPGWMM
SSVNLGNNLVNIGSASLATIVAIEIFGDNGVGIAVGIMTFLVIIFGEVTPKTYCNANATK
VALRCSRILLTFSYVFYPAVWILEKITRGIIKITGSDYQPPALTEDEIKGIIAQGHRDEA
LEKSERDLLYGALKFDDTVIRSVMMPRTRMFSLHGDMELITAADKIHKSGHSRIPIYGKD
HDDILGILHVRDILKHLKDKELQKMKLREFVREPIYVSQEKRMSELLKQMQAKNTHMAIV
VDEFGGVEGLVTLEDLIEEIVGEIHDETDLKSPHYQKINNDVILANGEIEIDEINEIFKS
NLPRGDDYSTLNGLLHEKLHDIPQVGNVINIDALEIKVEKVSKNKPVSLRITKKKPLEEN
LD
Download sequence
Identical sequences A9A3H1
gi|161528515|ref|YP_001582341.1| 436308.Nmar_1007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]