SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161528772|ref|YP_001582598.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528772|ref|YP_001582598.1|
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 0.0000000000000131
Family Ribosomal protein L39e 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161528772|ref|YP_001582598.1|
Sequence length 52
Comment 50S ribosomal protein L39e [Nitrosopumilus maritimus SCM1]
Sequence
MAARKSSPRKIRLLKKTKQASPVPAWIILKTKRSVRTNPKRRAWRSTDVEVG
Download sequence
Identical sequences A0A081RNX1 A0A087RQC9 A0A087RU06 A9A1I1
gi|161528772|ref|YP_001582598.1| 436308.Nmar_1264 WP_012215647.1.70052 WP_012215647.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]