SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161528809|ref|YP_001582635.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161528809|ref|YP_001582635.1|
Domain Number 1 Region: 93-223
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.44e-40
Family CTP-dependent riboflavin kinase-like 0.00013
Further Details:      
 
Domain Number 2 Region: 5-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000447
Family MarR-like transcriptional regulators 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161528809|ref|YP_001582635.1|
Sequence length 227
Comment hypothetical protein Nmar_1301 [Nitrosopumilus maritimus SCM1]
Sequence
MPELKIQHILTLSYLLSKGAKHNYVSITTSSLGKSIKKSQQAASKHLLELEQNQFIDRIM
SGRNVSVKITPKGFSEMVKLSTTLQKSLNSFPSHVELKGTLVSGMGEGAYYMGLKGYTKQ
FKSKIGYVPFPGTLNVRLDKKIHQEAVKQFETLDGIKIKSFSDGKRTYGWVKCFPAKLNN
SINCDMILLERTHHDNSVVELISKTCMRKTGKLKDGSKITIKIPISS
Download sequence
Identical sequences A9A2F8
436308.Nmar_1301 gi|161528809|ref|YP_001582635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]