SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161529054|ref|YP_001582880.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|161529054|ref|YP_001582880.1|
Domain Number - Region: 55-131
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00188
Family Cna protein B-type domain 0.012
Further Details:      
 
Domain Number - Region: 151-224
Classification Level Classification E-value
Superfamily E set domains 0.00247
Family Filamin repeat (rod domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161529054|ref|YP_001582880.1|
Sequence length 334
Comment hypothetical protein Nmar_1546 [Nitrosopumilus maritimus SCM1]
Sequence
MKLNILFLFFTILLIIQIPNSYAQFDTTDDEFVGLSLYTNSKVYAPSHNLQIYGTGLPEE
NLILRLFAPDETIAKFDQLTTNADGSYNHSLLTWPQPSSNLPYGTYTVEVISTAQNGISK
TIDVKFSSTTDLVDVPVERHVNTLVFAPETAAINQPIRVFVQTTSDGLLIGNEAGIKELL
GNTHVHLPSGMTVTLTSSFKALHQGLYYVDYTPIEEGTHVFHVIAFSQGTTSHGSAATNV
LSQDLGGISEQIIRLNTILDDTSKELDVLKSEIEGFDNTLETASSKIDESTGTISTSVEF
ISEASSQLNSLLFPIIASIGIIVALQIAILARRR
Download sequence
Identical sequences A9A4Y8
gi|161529054|ref|YP_001582880.1| 436308.Nmar_1546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]