SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161529068|ref|YP_001582894.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529068|ref|YP_001582894.1|
Domain Number 1 Region: 5-119,222-417
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.75e-95
Family Substrate-binding domain of HMG-CoA reductase 0.000000206
Further Details:      
 
Domain Number 2 Region: 113-217
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 3.4e-26
Family NAD-binding domain of HMG-CoA reductase 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161529068|ref|YP_001582894.1|
Sequence length 418
Comment hydroxymethylglutaryl-CoA reductase, degradative [Nitrosopumilus maritimus SCM1]
Sequence
MPDSSISKFFEKTRTERLDVIKNFANLSEDDVKSLELPDGGITFDKADKMVENAFGTFSL
PLGVATNFKINNKDYLVPMVIEEPSVIAAASKAAKLARPKGGFAVVADESYSIGQIQVLG
TDIDNAISKIKENIKEILELANSKSNTLSKMGKGAKEITCKKLDTDFEPMLIVELLIDVG
DAMGANVTNTMCEGVAPLIEKLTSGKTLLRILSNYSTRRMVKATAVFDKESVGGEKVVDN
MIHAYQFAKHDVYRAVTHNKGIMNGIIAVANATGQDSRAIEAAANAYASRSGQYRSLSEW
TKDSDGNLVGTLEIPLSVGIVGGIINVHPVAKICTKILGAESAKEMACIITATGLAQNFS
AMRALATDGIQKGHMRLHARNLASAAGASTEQIDKIVSQMIEENNISVNRAKELLEQN
Download sequence
Identical sequences A9A5X8
gi|161529068|ref|YP_001582894.1| 436308.Nmar_1560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]