SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161529070|ref|YP_001582896.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|161529070|ref|YP_001582896.1|
Domain Number - Region: 74-159
Classification Level Classification E-value
Superfamily vWA-like 0.0645
Family Integrin A (or I) domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161529070|ref|YP_001582896.1|
Sequence length 450
Comment hypothetical protein Nmar_1562 [Nitrosopumilus maritimus SCM1]
Sequence
MSELVTKNVVKKTVLNIGFDDTDSPKGMCTTFLAYKVVDLLKKQKTEFLDFPRLIRFNPN
IPWKTRGNGAVSIKIKTSNPSKIKNQIKNLVSKYSDTKNGANPGLVFFESDSIPNEFTKF
SNLALWQLINRNNAKKFAKKNNLEYFYKGNGQGLVGAIGAIGYDFNDHTLELLSYRKKQK
FGKERKISTKSVKEMQEKTYPDTFNSFDTKKGRVLITPHGPDPVFFGVRGENVDALVSAS
KILKSEEKLDGYMIFKSNQGTGDHLKNELTFETMKPYASGKLTGVVSNSPRIAKGGHVFF
KILSNGNEFWCAVYKPTGMSVIASNLIKGDKISVGGGVRKASKNFPRIINLEFIQIISLK
KQTKTSNPICKKCTKKMKSKGKGQGFECIRCGKKSSRKINEIVTRNLGPQLYLPKISAHR
HLTRPQQRQGIQNKSTNFKNSLSWFCVYQN
Download sequence
Identical sequences A9A5Y0
436308.Nmar_1562 gi|161529070|ref|YP_001582896.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]