SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161529160|ref|YP_001582986.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529160|ref|YP_001582986.1|
Domain Number 1 Region: 629-871
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 4.84e-36
Family SGL-like 0.013
Further Details:      
 
Domain Number 2 Region: 21-118
Classification Level Classification E-value
Superfamily E set domains 0.0000000000091
Family Copper resistance protein C (CopC, PcoC) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161529160|ref|YP_001582986.1|
Sequence length 927
Comment copper resistance D domain-containing protein [Nitrosopumilus maritimus SCM1]
Sequence
MQKFLIVLLMMSFISIPLASAHPFTEETIPSLTSSAPAGTTEVIVYFSEPIDINFSELRV
FDTNGNQIDNKDTAYYEGELSLIITTSPLEDGVYTVSTKVLSKVDGHLVPDAFLFAVGDV
VIDPSLLDVERPSEIIFLPEAGARFPGLIGQTIVLGAVIASLIIWGTQNKQLIREELDKI
GNFHQGKFMSITGIGLVLIFISNILMIAVQSIRLGVSPLDAIQTDFGITWILRMSITIII
LGIWFRLDRSKSLSKKNQILLLGAMLALISTSSLIGHGAASENIPALILDYIHNLVSGVW
IGGIIYFVFILLPTFSQLKETQREKMSLLMIPRFSITFIIAVGVIIITGPTLMWFLESDI
RLITESIYGQLIILKISIAAVIIAFGGFFQFKLQKKAEKNLESGKISVHKKLKKSLKVDV
VLGIVLLGVVALITNATLPAGEIQKIDAQEIIYGFETLEFTENAKFDIDISPFSSGSNTI
LVKVSDFEGNPLYDSNQLKVKVSNPSKNISPIEVPMEIIKQDKNRPIEFKGEMTFGFSGE
WLMEVEAQRTENANESKLLNLLVKPRLTDIQTQVIEYELPKDSKPLFPLYDGRDTLWVSD
ASAPRLWEFSLETQEFTSYSFDGLTTTFLTQDKDGKIWFTDTPRNQIGFIDPQTKEIITK
TIPKLDPVISDNTPLFIKADFDGNIWITIVNKDRIVKYIPENDEFEEIVLPGKENLPFAL
DIDVDGKMWYTTTGAGNIGYIDPKDNQITQFSNDPPLQGPEALLFDEDGNIWIAEHTGLA
ITKFNPVLETFERITVPNDEALPFGMTFDRYGNVWFAQHTIDSIGAYDPDNNNLIEVPVP
SETSFVQFMTSDGDSNVWFVEQQTSKIGTIKMTEIPVTASQIQSSGEFELKYTELASPLI
ALGIIATSLFYVKSIQDKRRLNELINS
Download sequence
Identical sequences A9A1N3
436308.Nmar_1652 gi|161529160|ref|YP_001582986.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]