SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161529190|ref|YP_001583016.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529190|ref|YP_001583016.1|
Domain Number 1 Region: 11-108
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000706
Family Multidrug resistance efflux transporter EmrE 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161529190|ref|YP_001583016.1|
Sequence length 109
Comment hypothetical protein Nmar_1682 [Nitrosopumilus maritimus SCM1]
Sequence
MVEVASTVGVFFFAALLEIGGGYLVWKWLRDHKGKVLGLIGGLVLFSYGIVMTLQPADFG
KVYATYGGIFVVSSIIWGYWVDKKRPDRYEVIGSVVVLIGVTIMFYWPR
Download sequence
Identical sequences A9A2Q1
436308.Nmar_1682 gi|161529190|ref|YP_001583016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]