SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161529199|ref|YP_001583025.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529199|ref|YP_001583025.1|
Domain Number 1 Region: 184-440
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-81
Family RecA protein-like (ATPase-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 449-559
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 9.16e-25
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0024
Further Details:      
 
Domain Number 3 Region: 3-72
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0000000000000961
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0068
Further Details:      
 
Weak hits

Sequence:  gi|161529199|ref|YP_001583025.1|
Domain Number - Region: 105-153
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0863
Family Biotinyl/lipoyl-carrier proteins and domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161529199|ref|YP_001583025.1|
Sequence length 592
Comment H+transporting two-sector ATPase alpha/beta subunit [Nitrosopumilus maritimus SCM1]
Sequence
MAAQGRIVWVSGPAVRADGMSEAKMYETVTVGDSKLVGEVIRLTGDVAFIQVYESTSGLK
PGEPVIGTGNPLSVLLGPGIIGQLYDGIQRPLRALSEASGSFIGRGITTTPVDMAKKYHF
VPSVSNGDEVAAGNVIGVVQETDLIEHSIMVPPDHKGGKISNLVSEGDYDLETVLATTEG
EGETVELKMYHRWPVRKPRPYKNRYDPTVPLLTGQRVIDTFFPIAKGGTGSIPGAFGTGK
TVTLHQIAKWADSQVVVYIGCGERGNEMTEVLVEFPHLKDPRSGKPLMDRTVLVANTSNM
PVAAREASIYTGVTIAEYYRDMGKDVVLVADSTSRWAEALREMSGRLEEMPAEEGYPSYL
ASRLAEFYERAGRVRAAGSPDRDGSVTLIGAVSPSGGDFTEPVTTHTMRFIKTFWALDAK
LAYSRHYPSINWMNSYSGYLADIAKWWGENINEDWLSLRSEVYGVLQREDTLKEIVRLLG
PEALPDEEKLILEVARMVKIGLLQQNSFDDVDTYCSPEKQYKLMKLLVDFYKKGQQAIKE
GTPLADIRAMKSITTLLKARMDVKDDEMPKLDQLDADMQEEFKSITGVKVSN
Download sequence
Identical sequences A9A2R0
436308.Nmar_1691 gi|161529199|ref|YP_001583025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]