SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161529221|ref|YP_001583047.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529221|ref|YP_001583047.1|
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.12e-60
Family ABC transporter ATPase domain-like 0.00000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161529221|ref|YP_001583047.1|
Sequence length 207
Comment ABC transporter [Nitrosopumilus maritimus SCM1]
Sequence
MSVEQGEIVLIVGSSGSGKSTLLNMIGLLDRPTSGKIYIDGTDTTTLDDDKISSFRNKKL
GFIFQFSNLLTDLTVLENVLLPRQIAGTNETAEKDARDLLKAVGLEDQMNKRANKISGGQ
AQRAAIARGLINKPSIVLADEPTGNLDSVTSETIVQLMKDMAKKLNQTFVIVTHDRQHFG
DVDKVITIKDGKAFEGDMPSEMEVLVK
Download sequence
Identical sequences A9A2T2
gi|161529221|ref|YP_001583047.1| 436308.Nmar_1713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]