SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161529248|ref|YP_001583074.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529248|ref|YP_001583074.1|
Domain Number 1 Region: 3-157
Classification Level Classification E-value
Superfamily Cyclophilin-like 8.18e-55
Family Cyclophilin (peptidylprolyl isomerase) 0.0000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161529248|ref|YP_001583074.1|
Sequence length 158
Comment peptidyl-prolyl isomerase [Nitrosopumilus maritimus SCM1]
Sequence
MTTANIETNFGKISFKLLPDLAPETVRNFEKLAKDGFYDGTLFHRVIPGFMIQGGDPNTK
TDNKSSWGTGGPGYNVKAEFNSRSHLRGIVSMARAQDPDSAGSQFFIVTADSTFLDRQYT
VFGEVTEGMDVADKIVNLERDGNDCPLEKAQMTRVTVE
Download sequence
Identical sequences A9A2V9
436308.Nmar_1740 gi|161529248|ref|YP_001583074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]