SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161529289|ref|YP_001583115.1| from Nitrosopumilus maritimus SCM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161529289|ref|YP_001583115.1|
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily LigT-like 3.14e-37
Family 2'-5' RNA ligase LigT 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161529289|ref|YP_001583115.1|
Sequence length 180
Comment 2'-5' RNA ligase [Nitrosopumilus maritimus SCM1]
Sequence
MRTFVAIEISENDIKKSIKDFQNKLQINAKPINSDQLHFTLQFLGEISEEQVQKVIESLQ
TIKFSEFTINLKGIGAFPKPKFPRVIWIGTDEEGGKNLIELAKKVENVLKPLGLVSDKPF
KPHITIFRIKKKIGDMTEELNKQKFMDFGMQKISRIMLKKSELTSDGPIYSNLEEVIAVK
Download sequence
Identical sequences A9A3X7
gi|161529289|ref|YP_001583115.1| 436308.Nmar_1781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]