SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157692609|ref|YP_001487071.1| from Bacillus pumilus SAFR-032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157692609|ref|YP_001487071.1|
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.38e-18
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157692609|ref|YP_001487071.1|
Sequence length 157
Comment hypothetical protein BPUM_1840 [Bacillus pumilus SAFR-032]
Sequence
MYDIVTLEKKWIKGLSVRTTNEMEQTKERKIAPLWQQFFAQQLHGGQAPVIGLYSDYEKD
EHGSYLFTAGQFVDQQLEQVIEIPASTYAKFRTRKGPIEEVVLETWQQIWTWDERHYRTY
TGDFEWYDERSLDPKEAQIDIYIAVDEKMLAKTNSIS
Download sequence
Identical sequences A8FE44
WP_012010235.1.28396 315750.BPUM_1840 gi|157692609|ref|YP_001487071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]