SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157691936|ref|YP_001486398.1| from Bacillus pumilus SAFR-032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157691936|ref|YP_001486398.1|
Domain Number 1 Region: 102-265
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.49e-38
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00046
Further Details:      
 
Domain Number 2 Region: 16-101
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000373
Family Sensory domain of two-component sensor kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157691936|ref|YP_001486398.1|
Sequence length 267
Comment chemotaxis sensory transducer protein [Bacillus pumilus SAFR-032]
Sequence
MTAAPYMMQILKNEVTMGVIDREKFLLYLPSKDVDFQIRAGERIKPDDMNMKKALRGETS
SMFVPESVYGVPLNAMGLPIFNENGQVIGALALGFPLKNQIELEAYMDSLNDIIQSIQEK
VHEVAAHSEELSATSEEMTLQTQQTLESSKQTADITKMIKGISRQTSLLGLNASIEAARA
GKEGAGFSVVASEVQKLSSETSRATENIESSLQGISSNIHTLLESMDHMKGSSSEQASLV
TEFSEIVDRLTTVSKDMKKFMQTVMST
Download sequence
Identical sequences gi|157691936|ref|YP_001486398.1| 315750.BPUM_1154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]