SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157693381|ref|YP_001487843.1| from Bacillus pumilus SAFR-032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157693381|ref|YP_001487843.1|
Domain Number 1 Region: 28-128
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000405
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157693381|ref|YP_001487843.1|
Sequence length 139
Comment hypothetical protein BPUM_2625 [Bacillus pumilus SAFR-032]
Sequence
MIIILYLSVALIAIAFLILVIYLSKTLKSLQLTLKNVASTLEGLEGQMQGITTETAQLLH
KTNQLAEDIQDKSAKLGTVVDAVQGIGGSINQFNTSIKQAAGAVSSSVERNQEKVTDVVS
WSNAALEIYKKWKQRKHQK
Download sequence
Identical sequences A0A200H3T3 A8FGB6
315750.BPUM_2625 WP_012010919.1.28396 WP_012010919.1.31616 WP_012010919.1.38286 WP_012010919.1.68823 WP_012010919.1.71185 WP_012010919.1.8214 gi|157693381|ref|YP_001487843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]