SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163843484|ref|YP_001627888.1| from Brucella suis ATCC 23445

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163843484|ref|YP_001627888.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.88e-37
Family Ribosomal protein L6 0.0000318
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.89e-22
Family Ribosomal protein L6 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163843484|ref|YP_001627888.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Brucella suis ATCC 23445]
Sequence
MSRIGKKPVPVPAGVTASVEGQTVKAKGAKGELSFVVHDEVLVKMEDGAVRVDPRDQSKE
ARSKWGMSRTMISNIFVGVKDGFEKKLEISGVGYRAAMQGKNLQLSLGFSHEVVYDVPAG
ITVAVPKPTEIVVTGIDKQQVGQVAAEIREYRGPEPYKGKGVKYAGEKIVRKEGKKK
Download sequence
Identical sequences A0A0E1X4Y7 A0A1G4F3C7 A0A1M4LBE0 A0A2D2BPP8 A0A2D3K5Q4 A5VQZ1 A9M5N5 B0CH17 C0RJI6 C7LCG8 C9VB20 D0RJC6 D6LKR0 N8LZB2 Q8G087
gi|148558950|ref|YP_001259138.1| gi|23502095|ref|NP_698222.1| gi|161619174|ref|YP_001593061.1| gi|384408693|ref|YP_005597314.1| gi|256369642|ref|YP_003107152.1| gi|384211585|ref|YP_005600667.1| gi|376276170|ref|YP_005116609.1| gi|225852715|ref|YP_002732948.1| gi|560146978|ref|YP_008839794.1| gi|163843484|ref|YP_001627888.1| gi|340790836|ref|YP_004756301.1| WP_004683920.1.100018 WP_004683920.1.100204 WP_004683920.1.100628 WP_004683920.1.100807 WP_004683920.1.101150 WP_004683920.1.101247 WP_004683920.1.101411 WP_004683920.1.102026 WP_004683920.1.10307 WP_004683920.1.1055 WP_004683920.1.10844 WP_004683920.1.10866 WP_004683920.1.11066 WP_004683920.1.1158 WP_004683920.1.11769 WP_004683920.1.11859 WP_004683920.1.11933 WP_004683920.1.12704 WP_004683920.1.12925 WP_004683920.1.12981 WP_004683920.1.13020 WP_004683920.1.1327 WP_004683920.1.13576 WP_004683920.1.13592 WP_004683920.1.14323 WP_004683920.1.14507 WP_004683920.1.15325 WP_004683920.1.16733 WP_004683920.1.17733 WP_004683920.1.1800 WP_004683920.1.18494 WP_004683920.1.19182 WP_004683920.1.19483 WP_004683920.1.19645 WP_004683920.1.20827 WP_004683920.1.2214 WP_004683920.1.22142 WP_004683920.1.22340 WP_004683920.1.23391 WP_004683920.1.23458 WP_004683920.1.24496 WP_004683920.1.24607 WP_004683920.1.2483 WP_004683920.1.24895 WP_004683920.1.24923 WP_004683920.1.24971 WP_004683920.1.25135 WP_004683920.1.25450 WP_004683920.1.25561 WP_004683920.1.27052 WP_004683920.1.27564 WP_004683920.1.27794 WP_004683920.1.29765 WP_004683920.1.29997 WP_004683920.1.31463 WP_004683920.1.31635 WP_004683920.1.31644 WP_004683920.1.31680 WP_004683920.1.32779 WP_004683920.1.33032 WP_004683920.1.33289 WP_004683920.1.33466 WP_004683920.1.3390 WP_004683920.1.33907 WP_004683920.1.34183 WP_004683920.1.34225 WP_004683920.1.34423 WP_004683920.1.35338 WP_004683920.1.35577 WP_004683920.1.36149 WP_004683920.1.36712 WP_004683920.1.3681 WP_004683920.1.38343 WP_004683920.1.38790 WP_004683920.1.38925 WP_004683920.1.40138 WP_004683920.1.40189 WP_004683920.1.408 WP_004683920.1.4091 WP_004683920.1.41105 WP_004683920.1.41344 WP_004683920.1.41893 WP_004683920.1.41941 WP_004683920.1.42065 WP_004683920.1.4207 WP_004683920.1.42071 WP_004683920.1.42633 WP_004683920.1.42774 WP_004683920.1.4295 WP_004683920.1.43006 WP_004683920.1.43058 WP_004683920.1.43148 WP_004683920.1.4319 WP_004683920.1.43359 WP_004683920.1.43583 WP_004683920.1.43689 WP_004683920.1.43928 WP_004683920.1.44045 WP_004683920.1.44060 WP_004683920.1.44294 WP_004683920.1.44541 WP_004683920.1.44793 WP_004683920.1.44949 WP_004683920.1.44989 WP_004683920.1.45546 WP_004683920.1.47843 WP_004683920.1.48075 WP_004683920.1.48184 WP_004683920.1.48396 WP_004683920.1.48744 WP_004683920.1.48948 WP_004683920.1.49427 WP_004683920.1.49542 WP_004683920.1.49753 WP_004683920.1.49942 WP_004683920.1.49953 WP_004683920.1.50924 WP_004683920.1.51553 WP_004683920.1.52027 WP_004683920.1.52478 WP_004683920.1.52541 WP_004683920.1.5307 WP_004683920.1.53843 WP_004683920.1.54481 WP_004683920.1.55047 WP_004683920.1.55284 WP_004683920.1.5609 WP_004683920.1.56313 WP_004683920.1.56621 WP_004683920.1.56947 WP_004683920.1.57541 WP_004683920.1.57564 WP_004683920.1.58260 WP_004683920.1.58868 WP_004683920.1.59091 WP_004683920.1.5971 WP_004683920.1.59985 WP_004683920.1.60134 WP_004683920.1.60631 WP_004683920.1.60920 WP_004683920.1.61081 WP_004683920.1.61543 WP_004683920.1.61961 WP_004683920.1.62592 WP_004683920.1.62872 WP_004683920.1.62990 WP_004683920.1.62997 WP_004683920.1.63732 WP_004683920.1.6440 WP_004683920.1.64585 WP_004683920.1.64849 WP_004683920.1.65299 WP_004683920.1.65501 WP_004683920.1.65597 WP_004683920.1.65651 WP_004683920.1.66078 WP_004683920.1.66268 WP_004683920.1.66340 WP_004683920.1.66407 WP_004683920.1.66647 WP_004683920.1.66855 WP_004683920.1.67107 WP_004683920.1.67402 WP_004683920.1.67659 WP_004683920.1.68488 WP_004683920.1.69997 WP_004683920.1.70160 WP_004683920.1.70296 WP_004683920.1.70570 WP_004683920.1.70760 WP_004683920.1.71002 WP_004683920.1.71228 WP_004683920.1.72189 WP_004683920.1.72439 WP_004683920.1.72533 WP_004683920.1.73628 WP_004683920.1.73739 WP_004683920.1.7388 WP_004683920.1.74005 WP_004683920.1.7410 WP_004683920.1.74236 WP_004683920.1.75128 WP_004683920.1.75563 WP_004683920.1.75678 WP_004683920.1.7667 WP_004683920.1.76877 WP_004683920.1.77165 WP_004683920.1.77281 WP_004683920.1.77683 WP_004683920.1.77685 WP_004683920.1.78225 WP_004683920.1.78716 WP_004683920.1.79327 WP_004683920.1.79993 WP_004683920.1.80059 WP_004683920.1.8012 WP_004683920.1.80167 WP_004683920.1.80365 WP_004683920.1.81027 WP_004683920.1.81377 WP_004683920.1.81558 WP_004683920.1.82205 WP_004683920.1.8223 WP_004683920.1.82390 WP_004683920.1.82448 WP_004683920.1.82565 WP_004683920.1.82595 WP_004683920.1.82834 WP_004683920.1.82990 WP_004683920.1.83161 WP_004683920.1.83513 WP_004683920.1.84512 WP_004683920.1.84540 WP_004683920.1.84601 WP_004683920.1.84764 WP_004683920.1.85684 WP_004683920.1.85721 WP_004683920.1.85753 WP_004683920.1.86832 WP_004683920.1.86901 WP_004683920.1.86923 WP_004683920.1.87222 WP_004683920.1.87893 WP_004683920.1.88404 WP_004683920.1.88658 WP_004683920.1.88867 WP_004683920.1.89113 WP_004683920.1.90027 WP_004683920.1.90420 WP_004683920.1.9096 WP_004683920.1.91081 WP_004683920.1.9163 WP_004683920.1.91958 WP_004683920.1.92383 WP_004683920.1.9303 WP_004683920.1.93230 WP_004683920.1.93367 WP_004683920.1.94513 WP_004683920.1.94648 WP_004683920.1.94770 WP_004683920.1.95141 WP_004683920.1.95148 WP_004683920.1.95178 WP_004683920.1.95770 WP_004683920.1.96661 WP_004683920.1.96710 WP_004683920.1.97320 WP_004683920.1.97331 WP_004683920.1.97860 WP_004683920.1.98362 WP_004683920.1.98704 WP_004683920.1.98764 204722.BR1218 444178.BOV_1181 470137.BSUIS_A1267 483179.BCAN_A1241 546272.BMEA_A1263 568815.BMI_I1229 gi|560149558|ref|YP_008842352.1| gi|23502095|ref|NP_698222.1| gi|376280889|ref|YP_005154895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]