SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157803324|ref|YP_001491873.1| from Rickettsia canadensis str. McKiel

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157803324|ref|YP_001491873.1|
Domain Number 1 Region: 15-235
Classification Level Classification E-value
Superfamily Ribosomal protein L1 7.33e-77
Family Ribosomal protein L1 0.00000096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157803324|ref|YP_001491873.1|
Sequence length 239
Comment 50S ribosomal protein L1 [Rickettsia canadensis str. McKiel]
Sequence
MSNKKDIAVKNSGGKKIREAREKVKSDTLYNLTNAVERLKSASYVKFDPTLEIVMKLGID
PRHSDQMIRGVVNLPAGTGKTVRVAVICKAERVEEAKSAGADLVGSTSIIDEIKAGKINF
DVCIATPDMMAAIGSVARILGPKGLMPNPKLGTVTLDIKNAIKNAKSGQVEYRAEKAGII
HAGLGKLSFSDQDLLQNLNEFIEAVIKAKPAGLKGSYLKAMYLSSTMGASVQIDLTSIA
Download sequence
Identical sequences A8EXK5
293613.A1E_00700 WP_012148289.1.34775 gi|157803324|ref|YP_001491873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]