SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557827266|ref|YP_008799721.1| from Exiguobacterium sp. MH3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557827266|ref|YP_008799721.1|
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily Formyltransferase 1.7e-57
Family Formyltransferase 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557827266|ref|YP_008799721.1|
Sequence length 191
Comment hypothetical protein U719_02395 [Exiguobacterium sp. MH3]
Sequence
MKIACFASGSGSNVEALFEAIEAGTLHASIELIVCDQPDAAVIERAKRRGCDVFVFRAKD
YPDKPSFEREIIARLEAKGVERIILAGYMRLIGEELLGRYAGRIVNIHPSLLPAFPGKDA
IGQAFRGGVKITGVTIHIVDEGMDTGPIMAQEAVRITEEMTRETLQQAIQRVEHRLYPQV
IEEWMKEEANV
Download sequence
Identical sequences A0A0V8GCT8
gi|557827266|ref|YP_008799721.1| WP_023467073.1.15129 WP_023467073.1.36954 WP_023467073.1.43456 WP_023467073.1.54908 WP_023467073.1.79814 WP_023467073.1.88029 WP_023467073.1.90003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]