SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557827455|ref|YP_008799916.1| from Exiguobacterium sp. MH3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557827455|ref|YP_008799916.1|
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 3.14e-39
Family Hypothetical protein YfhH 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557827455|ref|YP_008799916.1|
Sequence length 106
Comment hypothetical protein U719_03390 [Exiguobacterium sp. MH3]
Sequence
METRMSQLSKYELEMLITKLSEQKRKAEQHGNVSEVEVVTRKIAIAKSYLIDPARFERGA
FYRIEGEEARFELHFVNGVMGWGHFEGTAQEVAIPLALFTGEGEQT
Download sequence
Identical sequences A0A031ICI4 A0A0V8GD38 A0A177S851
gi|557827455|ref|YP_008799916.1| WP_023467306.1.148 WP_023467306.1.15129 WP_023467306.1.23883 WP_023467306.1.33445 WP_023467306.1.36954 WP_023467306.1.43456 WP_023467306.1.51126 WP_023467306.1.54908 WP_023467306.1.79814 WP_023467306.1.88029 WP_023467306.1.89373 WP_023467306.1.90003 WP_023467306.1.91825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]