SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557828881|ref|YP_008801595.1| from Exiguobacterium sp. MH3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557828881|ref|YP_008801595.1|
Domain Number 1 Region: 292-512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.85e-41
Family ABC transporter ATPase domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 18-288
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.1e-25
Family DNA repair protein MutS, domain III 0.019
Further Details:      
 
Domain Number 3 Region: 711-787
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000445
Family Smr domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557828881|ref|YP_008801595.1|
Sequence length 788
Comment DNA mismatch repair protein MutS [Exiguobacterium sp. MH3]
Sequence
MNANALRVLEYEKLKENMLSFTASSLGAQFVRAMRPAEEFEQVKELLAVTTEATTVYRLR
DRYPFGGLTDVRSEVKRAEIGSVLSTSELLSVADVVYSGRQVKAFQERLHEDHPDLRLPR
LDSRIEQITKLVEIEQGIRHAIDDQGTVQDSASDKLRALRSQLRSLEGQVRSKIDSVLRS
KAKMLSDAIVTMRNDRYCVPVKQEYRQAFGGIVHDQSASGATLFIEPQAVVSANNEIQEA
RLKERAEIERILAQLSALVGSVGDSLRINLDVLAELDFIMAKALYGHQIGAVEPRLNENR
HIILKEARHPFIPKEEVVPITVSLGGDFTSLVITGPNTGGKTVTLKTIGLLQLMVQSGLY
VPAADETELSVFDAIYADIGDEQSIEQNLSTFSSHMTNIVSMMEKIDFMSLVLFDELGAG
TDPTEGAALAIAILDEVKRRGARVAATTHYSELKAYGYNREGVVNASMEFDVESLSPTYR
LLIGVPGRSNAFEISKRLGLEDRIIDAARGQIGSDAQSVETMIERLEEAKQRAETLEAQL
LEEKKRLVAEREQFEQEQAEIQEEKNEILAKAEEKAARAVERAQKEAEGVIKRLKELRDA
GAVKEHELIEARKKLEDAKPSLQEKRIAKVKAKYDQTPRFDKGEEVKVTTFNQKGYIINQ
QANGEYTVQVGIMKVNVKPEDLAKIGSTPKRPQTKGRSGGTSVTKQSAPSAELDLRGVRV
EEGLSKLERFMDQALLSNYDHIRVIHGLGTGAMRQGVQEFLKGHRHVKGHRLGGQGEGGH
GVTIIELK
Download sequence
Identical sequences A0A177SLE1
WP_023469002.1.23883 WP_023469002.1.51126 WP_023469002.1.79814 WP_023469002.1.90003 gi|557828881|ref|YP_008801595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]