SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557828889|ref|YP_008801603.1| from Exiguobacterium sp. MH3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557828889|ref|YP_008801603.1|
Domain Number 1 Region: 214-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.41e-72
Family B3/B4 domain of PheRS, PheT 0.00000586
Further Details:      
 
Domain Number 2 Region: 36-196
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-44
Family Myf domain 0.0047
Further Details:      
 
Domain Number 3 Region: 470-688
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.19e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000949
Further Details:      
 
Domain Number 4 Region: 700-797
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 9.94e-32
Family Anticodon-binding domain of PheRS 0.00032
Further Details:      
 
Domain Number 5 Region: 408-477
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.94e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557828889|ref|YP_008801603.1|
Sequence length 798
Comment phenylalanyl-tRNA synthase subunit beta [Exiguobacterium sp. MH3]
Sequence
MLVSKQWLNEYVDVSHTSGQDLADLITKSGIEVEGVDVRDEALNNIVVGRVLTKEKHPEA
DKLNVTTVDIGQDEPVQIVCGAPNVEAGQDVIVARVGARLPGIKIKRAKLRGVVSEGMIC
SLEELGFEKKYIREDEQDGIHTFREPVTPGQDVLELLGLRDEILELGLTPNRSDCLSMYG
VAYEVAALYDTTPTFPVVEVNEAETATAVDVKLDSEDCPFYAAREIQGVTIQESPTWLKN
RLIANGIRPINNVVDVTNFVLLETGQPLHSFDAEKLGKRIVVRQAHAGESFTTLDEVERT
LDSSMLVITDGEHPVALAGVMGGANTEVDENTTSIILESAYFAPISVRKTSRVLGLRSDS
SARFEKGVDPRRVLLALDRAATLIAELSGGTVQAGVAQAGTLELDDHLIEASVSYINHRL
GMEIEGTVMQTLLERLGLGVELSGDALTVSVPTRRQDLKIPADLAEEVARLYGYDALTSS
LPSEASRGFLPKRNIHRRHLRRTLQGAGLSQAITYSLTSEQRAMQFNEREDLHPVKLAMP
ISEARSTLRTSLIPGLLEVAQHNVARQHADVAFYELGSVYLQRDASLETLPIEQEMIGGV
AVGVSEQHRAHGTLVKTDFFVMKGIVETLASAVGVTLTFEAASIPSMHPGRTARILLDGE
AIGFVGQVHPGLSKEQYGLKEVYVFELEAMALRSKEEQVYSEISRFPSMTRDLAIVVERS
VTAQSIVDVMTEAAGPLLQTIELFDVYTGENVGENEKSFAFSLRYQNKERTLVDEEITTA
QQRVVDAVKETFNAELRA
Download sequence
Identical sequences WP_023469010.1.79814 gi|557828889|ref|YP_008801603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]