SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157736388|ref|YP_001489071.1| from Arcobacter butzleri RM4018

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157736388|ref|YP_001489071.1|
Domain Number 1 Region: 4-378
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 7.19e-100
Family Homocysteine S-methyltransferase 0.0000111
Further Details:      
 
Domain Number 2 Region: 336-603
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 5.63e-71
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00026
Further Details:      
 
Domain Number 3 Region: 878-1159
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 4.32e-68
Family Methionine synthase SAM-binding domain 0.0036
Further Details:      
 
Domain Number 4 Region: 713-844
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.57e-34
Family Cobalamin (vitamin B12)-binding domain 0.0002
Further Details:      
 
Domain Number 5 Region: 625-710
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.53e-19
Family Methionine synthase domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157736388|ref|YP_001489071.1|
Sequence length 1159
Comment 5-methyltetrahydrofolate--homocysteine methyltransferase [Arcobacter butzleri RM4018]
Sequence
MEELIKNLIDKRVLIIDGAMGTQLQIADIKKEEWFFEDLDLEGCNELLNLTAPHILETIH
DNYAKAGADLISTNTFGSMPWVLDEYNIGHMSYELSKLGASLVKKSCEKFSTPEKPRFCL
ASIGPGTKLPSLGHIKYDEMYEGYKIMAKGLVDGGTDIFLLETCQDPLQIKAALHALNDV
APNIPIMVSVTIELSGTMLIGTDAMTIAAIMAPFNILSLGFNCGTGPVQVHKHVKTLSQV
CKFPISVHSNAGLPQNRGGKTYYPMQPEEFTALQKEFLKINGVSFLGGCCGTTPEHIEAL
AKAVENEIPLKPCGFLKASLASLFNIVPLKQEPAPLLIGERSNATGSKAFRELLKANDYE
GTLSVAQQQVRAGAHVIDVSVGFAGRDERFDMDEVVSLYSQKIALPLMPDSTQILALEAA
LKQIGGRCIINSVNLEDGIEKFDAVCSLAKKFGAALVCLVIDEIGMAKSKERKLEVAERI
FDLCVNRHGFDPADLVFDMLTFTIGSGDDEYRTAGIETLEAIREFEIRHPEVGTTLGLSN
ISFGLATNARIYLNSIYLDHCVKAGLTSAIVNVKHILPLNKISEEDKKACDNLIFNIWEN
GADPLFAFIEHFSNVEGQEEQSDEEYQKLEPIEKVKKLLLDGDKERLIPLALELRHTISP
EIIVNEWLIDGMKVIGELFGSGQMQLPFVLQSAETMKACVDSLNPYLPKQEKASETTLIL
GTVKGDVHDVGKNLVDIILSNNGFKVVNVGIKADLGQFVEELNKHNAHAIGMSGLLVKST
AVMKENLEELQKLGIKVPVLLGGAALTKNFVDEYCRTIYDGPIFYCRDAFDGVVSMQRIE
KGDENNTALAADLIERIDTSDRVEKEEIEIPSYEEISMPERGKFVFPPIWDRVTKRGEKL
NKELIFKWINHRVLFRQRWGYKRGKQTPEAFMKYERDVVEPTYEALKAELVDKDIFDPIA
IYAYYPCISHDNKLYIFDKKYLFNSLEESKNIPPLSEAIKVLEFPRQKRKPFRCIPDFFA
NDRLDVVAFTLASAGLKITDYERSLYDNGEFTKYYQVHGLGVELAEALAEVLHKQIRLDL
DIVPNEGHTLNDVQMKQYVGCRYSPGYAACPDLAMNRDIFDLLNPEEFGIELSETFQMHP
EQTTCAIVVTNPEANYYNV
Download sequence
Identical sequences A8ER28
367737.Abu_0117 WP_012012017.1.47628 gi|157736388|ref|YP_001489071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]