SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157737298|ref|YP_001489981.1| from Arcobacter butzleri RM4018

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157737298|ref|YP_001489981.1|
Domain Number 1 Region: 21-174
Classification Level Classification E-value
Superfamily PEBP-like 4.58e-49
Family Prokaryotic PEBP-like proteins 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157737298|ref|YP_001489981.1|
Sequence length 174
Comment hypothetical protein Abu_1052 [Arcobacter butzleri RM4018]
Sequence
MKKTILGLICCVSFLLANNFTLTSSDLKGQLTKKQEFNGFGCSGENISPQLSWENAPKGT
KSFAITVYDLDAPTGSGWWHWVVFDIPSNKTTLASGFGNSDSKEAIQSITDYGKTGFGGA
CPPVGDKAHRYIFTVHALDIETLGLDKNTNAATVGYYINSHSIAKASIISYYNR
Download sequence
Identical sequences A8ETN8
367737.Abu_1052 WP_012012756.1.47628 gi|157737298|ref|YP_001489981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]